PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10003123
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family M-type_MADS
Protein Properties Length: 63aa    MW: 6957.17 Da    PI: 10.4814
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10003123genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF76.61.9e-24959151
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                 krie+ks  qvtfskRr+g++KKA E+SvLCd+  a+ +fs+ g+ly+++s
  Lus10003123  9 KRIEDKSSCQVTFSKRRKGLIKKAGEISVLCDVHLALAVFSPGGRLYDFCS 59
                 79***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006627.137161IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.09E-25160IPR002100Transcription factor, MADS-box
SMARTSM004323.3E-31160IPR002100Transcription factor, MADS-box
PRINTSPR004044.7E-24323IPR002100Transcription factor, MADS-box
PfamPF003194.4E-231057IPR002100Transcription factor, MADS-box
PRINTSPR004044.7E-242338IPR002100Transcription factor, MADS-box
PRINTSPR004044.7E-243859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 63 aa     Download sequence    Send to blast
MGRRKVELKR IEDKSSCQVT FSKRRKGLIK KAGEISVLCD VHLALAVFSP GGRLYDFCSG  60
DR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-17161161Myocyte-specific enhancer factor 2B
1tqe_Q2e-17161161Myocyte-specific enhancer factor 2B
1tqe_R2e-17161161Myocyte-specific enhancer factor 2B
1tqe_S2e-17161161Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015387454.11e-25PREDICTED: MADS-box transcription factor 14-like isoform X2
RefseqXP_015387456.18e-26PREDICTED: MADS-box transcription factor 18-like isoform X4
SwissprotQ9S7Q77e-23FLC_ARATH; MADS-box protein FLOWERING LOCUS C
TrEMBLB2LBD69e-27B2LBD6_PONTR; Flowering locus C variant 2
TrEMBLB2LBD83e-27B2LBD8_PONTR; Flowering locus C variant 3
TrEMBLB2LBD91e-26B2LBD9_PONTR; Flowering locus C variant 5
TrEMBLB2LBE01e-26B2LBE0_PONTR; Flowering locus C variant 9
TrEMBLB2M1T81e-26B2M1T8_PONTR; Flowering locus C variant 7
STRINGPOPTR_0001s13660.12e-24(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11933360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10140.25e-25MIKC_MADS family protein